(data stored in ACNUC7421 zone)

EMBL: CP000489.PE222

CP000489.PE222       Location/Qualifiers
FT   CDS             complement(207290..207832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0225"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: rsp:RSP_3957 flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68339"
FT                   /db_xref="GOA:A1AYJ5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ5"
FT                   /protein_id="ABL68339.1"
FT                   /translation="MPSFSFPCLDGDPEFRESLRTALRGTAVNVSILTARDRAGMNHGI
FT                   AVTTAVPFSTYRPAMIVAVKHSASAYPAILDSNYFCLNQIAADEIDLLDRFSRSDRRTS
FT                   RFATGCWSVGPFCLPYLGSALTSYFCDVQGAHDHEDQTVFIGRIVGVRLGNDGTGGRDP
FT                   LMWINGRAARLAGREYV"
     MPSFSFPCLD GDPEFRESLR TALRGTAVNV SILTARDRAG MNHGIAVTTA VPFSTYRPAM        60
     IVAVKHSASA YPAILDSNYF CLNQIAADEI DLLDRFSRSD RRTSRFATGC WSVGPFCLPY       120
     LGSALTSYFC DVQGAHDHED QTVFIGRIVG VRLGNDGTGG RDPLMWINGR AARLAGREYV       180
//

If you have problems or comments...

PBIL Back to PBIL home page