(data stored in ACNUC7421 zone)

EMBL: CP000489.PE225

CP000489.PE225       Location/Qualifiers
FT   CDS             complement(209307..209846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0228"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_5864 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68342"
FT                   /db_xref="GOA:A1AYJ8"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYJ8"
FT                   /protein_id="ABL68342.1"
FT                   /translation="MSHPVHALDSFFYTSMGVYAFESQCEMLAELGYDGITVSAWGGQP
FT                   MTDLSLLPTVKERHGLDVAALYAVLHEGRNDAIIRRIIESVEGVELIELAVQTSLNGEA
FT                   AILRNIEALLPIAERRGLRIALYPHLRHVTQTTSEVVRLCEYFDHPLLGASFNGYHWYA
FT                   SRRAGWRNASPRSSPG"
     MSHPVHALDS FFYTSMGVYA FESQCEMLAE LGYDGITVSA WGGQPMTDLS LLPTVKERHG        60
     LDVAALYAVL HEGRNDAIIR RIIESVEGVE LIELAVQTSL NGEAAILRNI EALLPIAERR       120
     GLRIALYPHL RHVTQTTSEV VRLCEYFDHP LLGASFNGYH WYASRRAGWR NASPRSSPG        179
//

If you have problems or comments...

PBIL Back to PBIL home page