(data stored in ACNUC7421 zone)

EMBL: CP000489.PE228

CP000489.PE228       Location/Qualifiers
FT   CDS             211824..212726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0231"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_1980 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68345"
FT                   /db_xref="GOA:A1AYK1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK1"
FT                   /protein_id="ABL68345.1"
FT                   /translation="MNSFGTLAAFVHSAETRSFTEAGRRLGISSSAVGKTVARLEEELG
FT                   VRLFHRSTRAITLTAEGCRFLDRCYRIFAEFDDAKRELTQAAGKPQGKLRVGLPQIGIH
FT                   LMPHLIAFQRTFPEIELELDFSDRLVNLVEEGFDAVMRIGELNDSRLTMRRLDGYHHRL
FT                   VAAPAYLAHRGTPDRPAELMDHACLRYRYPTTGKLAPWPLNGRGGAPSIDPPQSSVTNS
FT                   IDSLLEMVQAGLGIALLPDFIVADAVAAGRLTVVLDRHGQDRRDFCILWPSSRHTAPKI
FT                   KAFVDFMVSRLGAAGALQR"
     MNSFGTLAAF VHSAETRSFT EAGRRLGISS SAVGKTVARL EEELGVRLFH RSTRAITLTA        60
     EGCRFLDRCY RIFAEFDDAK RELTQAAGKP QGKLRVGLPQ IGIHLMPHLI AFQRTFPEIE       120
     LELDFSDRLV NLVEEGFDAV MRIGELNDSR LTMRRLDGYH HRLVAAPAYL AHRGTPDRPA       180
     ELMDHACLRY RYPTTGKLAP WPLNGRGGAP SIDPPQSSVT NSIDSLLEMV QAGLGIALLP       240
     DFIVADAVAA GRLTVVLDRH GQDRRDFCIL WPSSRHTAPK IKAFVDFMVS RLGAAGALQR       300
//

If you have problems or comments...

PBIL Back to PBIL home page