(data stored in ACNUC7421 zone)

EMBL: CP000489.PE229

CP000489.PE229       Location/Qualifiers
FT   CDS             complement(212737..213429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0232"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pae:PA3678
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68346"
FT                   /db_xref="GOA:A1AYK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK2"
FT                   /protein_id="ABL68346.1"
FT                   /translation="MQALLFSEPTGKVNRNGMAAKQESPAGRGRGKPRDAGLRERILKA
FT                   AEAEFLDEGLEGARMERIAMRAGTSKMALYQHFASKMVLFHQVRNNLLIDHLPHVDQFP
FT                   LDAEPRQVLAQIAKRYLKAITAAATIQQLHLLCQPRARDVRAATAFFDTGPQAAVRQVD
FT                   ALLQRYCDQGVFAIPAPRMAAEQFLAMVRGNEHMRALLDLPPGRDEQALDIYLASCVDL
FT                   FMRAFRAE"
     MQALLFSEPT GKVNRNGMAA KQESPAGRGR GKPRDAGLRE RILKAAEAEF LDEGLEGARM        60
     ERIAMRAGTS KMALYQHFAS KMVLFHQVRN NLLIDHLPHV DQFPLDAEPR QVLAQIAKRY       120
     LKAITAAATI QQLHLLCQPR ARDVRAATAF FDTGPQAAVR QVDALLQRYC DQGVFAIPAP       180
     RMAAEQFLAM VRGNEHMRAL LDLPPGRDEQ ALDIYLASCV DLFMRAFRAE                  230
//

If you have problems or comments...

PBIL Back to PBIL home page