(data stored in ACNUC7421 zone)

EMBL: CP000489.PE230

CP000489.PE230       Location/Qualifiers
FT   CDS             213456..215417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0233"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: gme:Gmet_2060 fusaric acid resistance protein
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68347"
FT                   /db_xref="GOA:A1AYK3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK3"
FT                   /protein_id="ABL68347.1"
FT                   /translation="MARWTAFRNGPMTKLNGALRDPHIRATALRLTLAAMIAMVVATGL
FT                   GLQNPWWAAMATWMIGQPPRGLLLERSVAQFAGTLLGAAAGVAITLAGNPSLQLAWLAL
FT                   WLALCCGLTNAMRHQRAYGAALAGLTASVVVTLTTGTEIAPVSFAGARIADTLIGIGAA
FT                   LAVGFMLQPRARAQTLSARSATVLADGLRLVGMALQQHQTDLVARESAFLSTLAAISAG
FT                   AEDAAAGSLRARRGLRPLNTIFASLLDLIVVARMIRKASESRSITRQADLAALRAELER
FT                   AADALQETGKLDPLPALGMAERIAADHAELKAILGSFAAELREIAQSHQALAHPGRTVC
FT                   AARLHPQPDLTGLRRAMARGFLAIAASALVWTVTGWEAGRFLVLGASIFTVLFATLDQP
FT                   LPLVRQGLIGGAVAALAAVAWRLDVVPFAEVPWFSLLLALPLFCAASLLQASRATIFAG
FT                   LTFNMFFAVLARPVDMLPSSSQVVVASAAMLILGVAISDFFYRWVLPMDVDRRRRHIEA
FT                   SIRREIVSVSLRAGTPWAERHLSRLRHLVLEMVMRARADTEVVGNAVAALSLGHIAMRL
FT                   GQIAHQETPAADGGAITKDCLRRLANPISDPAACGREILKANQAVPAETATSAVRLAHL
FT                   MARELVDHPKVFTSSTAT"
     MARWTAFRNG PMTKLNGALR DPHIRATALR LTLAAMIAMV VATGLGLQNP WWAAMATWMI        60
     GQPPRGLLLE RSVAQFAGTL LGAAAGVAIT LAGNPSLQLA WLALWLALCC GLTNAMRHQR       120
     AYGAALAGLT ASVVVTLTTG TEIAPVSFAG ARIADTLIGI GAALAVGFML QPRARAQTLS       180
     ARSATVLADG LRLVGMALQQ HQTDLVARES AFLSTLAAIS AGAEDAAAGS LRARRGLRPL       240
     NTIFASLLDL IVVARMIRKA SESRSITRQA DLAALRAELE RAADALQETG KLDPLPALGM       300
     AERIAADHAE LKAILGSFAA ELREIAQSHQ ALAHPGRTVC AARLHPQPDL TGLRRAMARG       360
     FLAIAASALV WTVTGWEAGR FLVLGASIFT VLFATLDQPL PLVRQGLIGG AVAALAAVAW       420
     RLDVVPFAEV PWFSLLLALP LFCAASLLQA SRATIFAGLT FNMFFAVLAR PVDMLPSSSQ       480
     VVVASAAMLI LGVAISDFFY RWVLPMDVDR RRRHIEASIR REIVSVSLRA GTPWAERHLS       540
     RLRHLVLEMV MRARADTEVV GNAVAALSLG HIAMRLGQIA HQETPAADGG AITKDCLRRL       600
     ANPISDPAAC GREILKANQA VPAETATSAV RLAHLMAREL VDHPKVFTSS TAT              653
//

If you have problems or comments...

PBIL Back to PBIL home page