(data stored in ACNUC7421 zone)

EMBL: CP000489.PE231

CP000489.PE231       Location/Qualifiers
FT   CDS             215564..215908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_0382 b-ketoadipate enol-lactone
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68348"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK4"
FT                   /protein_id="ABL68348.1"
FT                   /translation="MRRLRTDDPAGVETTLASFAATSVDGHAGCCAALAEADLRDQLHR
FT                   IAHPLLAVSGDDDPVCPPAELAAIADGVQHGRHLSLPGRHIVSPESALQFNAALEEFLK
FT                   AGPARGGGTR"
     MRRLRTDDPA GVETTLASFA ATSVDGHAGC CAALAEADLR DQLHRIAHPL LAVSGDDDPV        60
     CPPAELAAIA DGVQHGRHLS LPGRHIVSPE SALQFNAALE EFLKAGPARG GGTR             114
//

If you have problems or comments...

PBIL Back to PBIL home page