(data stored in ACNUC7421 zone)

EMBL: CP000489.PE233

CP000489.PE233       Location/Qualifiers
FT   CDS             complement(216915..217913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0236"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rme:Rmet_5091 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68350"
FT                   /db_xref="GOA:A1AYK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK6"
FT                   /protein_id="ABL68350.1"
FT                   /translation="MAEPLLEISDLTLEFGPISNPVRVLNHVSLSVAAGEAVGLVGESG
FT                   SGKSMTSLATMRLLPASARLTSGRIRLEGHGDLLALPSDRMPEIRGRDIAMIFQEPMSS
FT                   LNPVMTVEAQIAEAIMLHQQMSREDRRARVIELLRLVGIPDPQARMKAYPHQMSGGMRQ
FT                   RVMIAIAVACNPRLLIADEPTTALDVTIQAQVLDLLREVRQRLGTAVLMISHDLGVISE
FT                   LCDRIVVMYAGHVVETATVDDLFDNPQHPYTRGLLRAVPSLETSARRLYQIPGSVPPPG
FT                   TIKAGCPFAPRCELKRDICTREMPALTPRGRDQRAACWVTADTPMTAEAIA"
     MAEPLLEISD LTLEFGPISN PVRVLNHVSL SVAAGEAVGL VGESGSGKSM TSLATMRLLP        60
     ASARLTSGRI RLEGHGDLLA LPSDRMPEIR GRDIAMIFQE PMSSLNPVMT VEAQIAEAIM       120
     LHQQMSREDR RARVIELLRL VGIPDPQARM KAYPHQMSGG MRQRVMIAIA VACNPRLLIA       180
     DEPTTALDVT IQAQVLDLLR EVRQRLGTAV LMISHDLGVI SELCDRIVVM YAGHVVETAT       240
     VDDLFDNPQH PYTRGLLRAV PSLETSARRL YQIPGSVPPP GTIKAGCPFA PRCELKRDIC       300
     TREMPALTPR GRDQRAACWV TADTPMTAEA IA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page