(data stored in ACNUC7421 zone)

EMBL: CP000489.PE234

CP000489.PE234       Location/Qualifiers
FT   CDS             complement(217913..218785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0237"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: psp:PSPPH_2784 dipeptide
FT                   transport system permease protein DppC AGR_L_321"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68351"
FT                   /db_xref="GOA:A1AYK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK7"
FT                   /protein_id="ABL68351.1"
FT                   /translation="MANSEAIPLPEAPRLRRLAGEVVAGRPAVIISLATVLVFAVIAIL
FT                   APWIAPRDPMAQSFIAINAMPSSDYLLGTDQFGRDLLSRLIYGSRNSLIFGLLSPVFAA
FT                   IAGTFLGVTAGYFGGWIDRVVTRIIDMLLAFPELLLAILVAAALGGGFWNVVAVLTIAF
FT                   TPGFARVARASTLAVKQEPYIEAAIASGVSTPVIIFRHVVPNISAPIVVLMTLWSASAI
FT                   RLEATLSFLGIGTQPPAPSWGNIIREGLGNMFATPWPILTGGLAITIVVLAISTIGDAV
FT                   RDALDPEIK"
     MANSEAIPLP EAPRLRRLAG EVVAGRPAVI ISLATVLVFA VIAILAPWIA PRDPMAQSFI        60
     AINAMPSSDY LLGTDQFGRD LLSRLIYGSR NSLIFGLLSP VFAAIAGTFL GVTAGYFGGW       120
     IDRVVTRIID MLLAFPELLL AILVAAALGG GFWNVVAVLT IAFTPGFARV ARASTLAVKQ       180
     EPYIEAAIAS GVSTPVIIFR HVVPNISAPI VVLMTLWSAS AIRLEATLSF LGIGTQPPAP       240
     SWGNIIREGL GNMFATPWPI LTGGLAITIV VLAISTIGDA VRDALDPEIK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page