(data stored in ACNUC7421 zone)

EMBL: CP000489.PE235

CP000489.PE235       Location/Qualifiers
FT   CDS             complement(218785..219720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0238"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ppu:PP_4455 opine ABC
FT                   transporter, periplasmic binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68352"
FT                   /db_xref="GOA:A1AYK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYK8"
FT                   /protein_id="ABL68352.1"
FT                   /translation="MTRYILTRLLDAVPTMLLVLTLVFLAMRVLPGDPALAALGDGAQP
FT                   EAIAQFRERFGLNDPLWLQYLHFMRDMLTFDFGASLMSGERVAQLLVSNLGYTVELTIA
FT                   AVLLGIMGGIPLGVMAALNRNRAPDAGFRVFSLLGYAIPDFYLGAVLLIVFSLSLGWFP
FT                   ISGAGDGFADRMHHLVLPALTLALLKVAFLGRLTRTALLEVLGRDFVRTARAKGARENR
FT                   VIYRHALRNALLPLSTGLGLSILSTLSGSVAVELVFNRPGLGKLLITAITERDYPIVQA
FT                   GVVVFAAAVVVVNLLMELVYVIIDPRIRVQ"
     MTRYILTRLL DAVPTMLLVL TLVFLAMRVL PGDPALAALG DGAQPEAIAQ FRERFGLNDP        60
     LWLQYLHFMR DMLTFDFGAS LMSGERVAQL LVSNLGYTVE LTIAAVLLGI MGGIPLGVMA       120
     ALNRNRAPDA GFRVFSLLGY AIPDFYLGAV LLIVFSLSLG WFPISGAGDG FADRMHHLVL       180
     PALTLALLKV AFLGRLTRTA LLEVLGRDFV RTARAKGARE NRVIYRHALR NALLPLSTGL       240
     GLSILSTLSG SVAVELVFNR PGLGKLLITA ITERDYPIVQ AGVVVFAAAV VVVNLLMELV       300
     YVIIDPRIRV Q                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page