(data stored in ACNUC7421 zone)

EMBL: CP000489.PE237

CP000489.PE237       Location/Qualifiers
FT   CDS             complement(221408..222094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0240"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mes:Meso_4461 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68354"
FT                   /db_xref="GOA:A1AYL0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL0"
FT                   /protein_id="ABL68354.1"
FT                   /translation="MTSRTKDQPRPKGRSIQRPGRLGDEVYEALYAQLMALEIPPGARI
FT                   SVDNLVRELGVSQTPIREALSRLEAQGLVVKTHLIGYSAASQIDEQRLEQLYDLRLLLE
FT                   PYAAGRAAVHMDDDDIARLVALDARMDEIHPDGKESYGEFAAADGQFHDLIAQGSGNEL
FT                   VRDALSRLYTHVHLFRLFYLASVTAEANDEHAAIVAAIVARDSAAAEEAMRRHVLESRK
FT                   RFTGRR"
     MTSRTKDQPR PKGRSIQRPG RLGDEVYEAL YAQLMALEIP PGARISVDNL VRELGVSQTP        60
     IREALSRLEA QGLVVKTHLI GYSAASQIDE QRLEQLYDLR LLLEPYAAGR AAVHMDDDDI       120
     ARLVALDARM DEIHPDGKES YGEFAAADGQ FHDLIAQGSG NELVRDALSR LYTHVHLFRL       180
     FYLASVTAEA NDEHAAIVAA IVARDSAAAE EAMRRHVLES RKRFTGRR                    228
//

If you have problems or comments...

PBIL Back to PBIL home page