(data stored in ACNUC7421 zone)

EMBL: CP000489.PE243

CP000489.PE243       Location/Qualifiers
FT   CDS             228259..229149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0246"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: msu:MS0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68360"
FT                   /db_xref="GOA:A1AYL6"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYL6"
FT                   /protein_id="ABL68360.1"
FT                   /translation="MMVRRAASVPGLSHVDLNYPDHVLEEPKVVQAEVNDLGLQVNGLA
FT                   MRYYTNPALKLGAFTNPDRAVRQEAIDLTKRGIDAALEMGAPLMTLWLGQDGFDYSFQG
FT                   DYPRMWEDEIGGIREVAEHAPDCMISIEYKPNEPRSYALLPDVATTLLAIAETGCGNIG
FT                   VTLDFAHVLYADEMPAYAATLIARKSRLLGVHLNDGYAKRDDGLMVGSVHPQATLELLW
FT                   QITRDGYDGVIYFDTFPDASGIDPVEECRTNIETVERFMNMVPRLNADNLLHDAIAGQN
FT                   SPLSQRAVARIMSGA"
     MMVRRAASVP GLSHVDLNYP DHVLEEPKVV QAEVNDLGLQ VNGLAMRYYT NPALKLGAFT        60
     NPDRAVRQEA IDLTKRGIDA ALEMGAPLMT LWLGQDGFDY SFQGDYPRMW EDEIGGIREV       120
     AEHAPDCMIS IEYKPNEPRS YALLPDVATT LLAIAETGCG NIGVTLDFAH VLYADEMPAY       180
     AATLIARKSR LLGVHLNDGY AKRDDGLMVG SVHPQATLEL LWQITRDGYD GVIYFDTFPD       240
     ASGIDPVEEC RTNIETVERF MNMVPRLNAD NLLHDAIAGQ NSPLSQRAVA RIMSGA           296
//

If you have problems or comments...

PBIL Back to PBIL home page