(data stored in ACNUC7421 zone)

EMBL: CP000489.PE247

CP000489.PE247       Location/Qualifiers
FT   CDS             232852..233715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0250"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: msu:MS0198 RpiR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68364"
FT                   /db_xref="GOA:A1AYM0"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM0"
FT                   /protein_id="ABL68364.1"
FT                   /translation="MMGHYDPRTVGAQIRMKLPFLTPLEARVVDTITGRNDLDLTTALR
FT                   QVSEDAGVSDAMVVKIAKKLGFNGFRDFREALVVYRQTDVASLHSEISPEDSSADIIRK
FT                   VFQTSIQALEETMSIIDVSAFDRAATLLHGARQRDFYGVGGSAQIARDVAHKFLRIGLR
FT                   AGVQDDPHMMLMSAALLGPEDVVVAFSHSGTTSNVIEAARLARQQGARVIAITNYATAP
FT                   LSELADIALCSTAQGSPLLGENAAARIAQLNIMDAIFVAVAQRDLERAEAQLARTRNAV
FT                   DNKRRR"
     MMGHYDPRTV GAQIRMKLPF LTPLEARVVD TITGRNDLDL TTALRQVSED AGVSDAMVVK        60
     IAKKLGFNGF RDFREALVVY RQTDVASLHS EISPEDSSAD IIRKVFQTSI QALEETMSII       120
     DVSAFDRAAT LLHGARQRDF YGVGGSAQIA RDVAHKFLRI GLRAGVQDDP HMMLMSAALL       180
     GPEDVVVAFS HSGTTSNVIE AARLARQQGA RVIAITNYAT APLSELADIA LCSTAQGSPL       240
     LGENAAARIA QLNIMDAIFV AVAQRDLERA EAQLARTRNA VDNKRRR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page