(data stored in ACNUC7421 zone)

EMBL: CP000489.PE250

CP000489.PE250       Location/Qualifiers
FT   CDS             complement(234955..235479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68367"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM3"
FT                   /protein_id="ABL68367.1"
FT                   /translation="MASLVLAPISRTRSSLPHSEDGRQVPPAPVWCRQAQTSRTEMPSS
FT                   AINGPPVTKLERSDKRNRAPYAISADLSIRFIRCRQVVKSSSRQPLGRIHELAVRAEQV
FT                   DEGQLPRRKDGAGGHAELAMTGRTFETPTGRQVVDISHPQADRPARHLSLATAVGRTGD
FT                   RRPPRHRRKSP"
     MASLVLAPIS RTRSSLPHSE DGRQVPPAPV WCRQAQTSRT EMPSSAINGP PVTKLERSDK        60
     RNRAPYAISA DLSIRFIRCR QVVKSSSRQP LGRIHELAVR AEQVDEGQLP RRKDGAGGHA       120
     ELAMTGRTFE TPTGRQVVDI SHPQADRPAR HLSLATAVGR TGDRRPPRHR RKSP             174
//

If you have problems or comments...

PBIL Back to PBIL home page