(data stored in ACNUC7421 zone)

EMBL: CP000489.PE252

CP000489.PE252       Location/Qualifiers
FT   CDS             236307..236864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68369"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM5"
FT                   /protein_id="ABL68369.1"
FT                   /translation="MMDMIARLRAERQDLVARLGEIDKILTQYKQIERAAQQLLGDHPP
FT                   VDSRAMTAGPVEPVAPHTPATVPDRAVSAKNKTPIEEFEQAVIDVLQETAAPLNRVQLY
FT                   DALTDRGIVIGDGDREKELNALSARVYRMTQTGRLTSRRGQGYSLKADGDVDGPRYDPQ
FT                   QEDLPRHQEVREADERDDELLG"
     MMDMIARLRA ERQDLVARLG EIDKILTQYK QIERAAQQLL GDHPPVDSRA MTAGPVEPVA        60
     PHTPATVPDR AVSAKNKTPI EEFEQAVIDV LQETAAPLNR VQLYDALTDR GIVIGDGDRE       120
     KELNALSARV YRMTQTGRLT SRRGQGYSLK ADGDVDGPRY DPQQEDLPRH QEVREADERD       180
     DELLG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page