(data stored in ACNUC7421 zone)

EMBL: CP000489.PE254

CP000489.PE254       Location/Qualifiers
FT   CDS             complement(237429..237779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa39970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68371"
FT                   /db_xref="InterPro:IPR025475"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYM7"
FT                   /protein_id="ABL68371.1"
FT                   /translation="MMPQRIQLKRTKGWRLPADAVKVDRSTRWGNPWRVGEPDITDAAE
FT                   AVRRFAHAVEGFMSNGSYCRPVAHPDSHIGRIISGIGDLRGKDLACWCPLDQPCHADVL
FT                   LRLANRGDERDG"
     MMPQRIQLKR TKGWRLPADA VKVDRSTRWG NPWRVGEPDI TDAAEAVRRF AHAVEGFMSN        60
     GSYCRPVAHP DSHIGRIISG IGDLRGKDLA CWCPLDQPCH ADVLLRLANR GDERDG           116
//

If you have problems or comments...

PBIL Back to PBIL home page