(data stored in ACNUC7421 zone)

EMBL: CP000489.PE259

CP000489.PE259       Location/Qualifiers
FT   CDS             complement(239981..240562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68376"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN2"
FT                   /protein_id="ABL68376.1"
FT                   /translation="MTAIGICLVCGCDRPIHARCLCNAHYKRFRRHGDPLGGNTSVGDP
FT                   IKFLKFAILYCGNNCLLWPFSKNPFGYGQIAIERFPKLVHRIVCEEVHGPPVRPDDHAA
FT                   HSCGNGHLGCVNPIHIRWATAKENEADKIIHGSRSRGERHGAHKLSEAHVRQIRRWRGT
FT                   MSCRDIGKLLGVSPSTVNRIHNGGRWGWLE"
     MTAIGICLVC GCDRPIHARC LCNAHYKRFR RHGDPLGGNT SVGDPIKFLK FAILYCGNNC        60
     LLWPFSKNPF GYGQIAIERF PKLVHRIVCE EVHGPPVRPD DHAAHSCGNG HLGCVNPIHI       120
     RWATAKENEA DKIIHGSRSR GERHGAHKLS EAHVRQIRRW RGTMSCRDIG KLLGVSPSTV       180
     NRIHNGGRWG WLE                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page