(data stored in ACNUC7421 zone)

EMBL: CP000489.PE264

CP000489.PE264       Location/Qualifiers
FT   CDS             complement(243957..244910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0267"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   eli:ELI_07940 putative bacteriophage-acquired protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68381"
FT                   /db_xref="GOA:A1AYN7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR024408"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN7"
FT                   /protein_id="ABL68381.1"
FT                   /translation="MSKPWKGAAQRATAQDFVTAAEELGCEVAALEAVWQIEASGKPFR
FT                   SDGTLERRFEPHKLRKPEGNYKTSAALSFAAREAKFDAAYARNAEDAMRASSWGGPQIM
FT                   GFNANAAGYPTAGAMVEAMAASESEQIRAFVRLIKAWGLASALRSHDWRAFAARYNGNA
FT                   NVAEYSARIETAYQKLSGRASPVVLRSGDKGVAVRRLQYALGIDVDGSFGPDTDKAVRD
FT                   FQKRHGLTVDGVVGQRTWKALEGYSGIQPVKQPAAQDRIAQASEIVALASTAAGAMATV
FT                   GGALPESSVNLLIIAAAVIGIGALALHAFRKLRGVA"
     MSKPWKGAAQ RATAQDFVTA AEELGCEVAA LEAVWQIEAS GKPFRSDGTL ERRFEPHKLR        60
     KPEGNYKTSA ALSFAAREAK FDAAYARNAE DAMRASSWGG PQIMGFNANA AGYPTAGAMV       120
     EAMAASESEQ IRAFVRLIKA WGLASALRSH DWRAFAARYN GNANVAEYSA RIETAYQKLS       180
     GRASPVVLRS GDKGVAVRRL QYALGIDVDG SFGPDTDKAV RDFQKRHGLT VDGVVGQRTW       240
     KALEGYSGIQ PVKQPAAQDR IAQASEIVAL ASTAAGAMAT VGGALPESSV NLLIIAAAVI       300
     GIGALALHAF RKLRGVA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page