(data stored in ACNUC7421 zone)

EMBL: CP000489.PE265

CP000489.PE265       Location/Qualifiers
FT   CDS             complement(244980..245237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68382"
FT                   /db_xref="GOA:A1AYN8"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN8"
FT                   /protein_id="ABL68382.1"
FT                   /translation="MPDWSAIQQVWPLLIAVAGVWAKLEVTMMRNREQSARNEAEITKL
FT                   EAQLEAQKLVTQKQGLTLARMEESLVSIGRTLERIDRKIP"
     MPDWSAIQQV WPLLIAVAGV WAKLEVTMMR NREQSARNEA EITKLEAQLE AQKLVTQKQG        60
     LTLARMEESL VSIGRTLERI DRKIP                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page