(data stored in ACNUC7421 zone)

EMBL: CP000489.PE266

CP000489.PE266       Location/Qualifiers
FT   CDS             complement(245264..245617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68383"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYN9"
FT                   /protein_id="ABL68383.1"
FT                   /translation="MANSANLALPYLAASQAQKHVTHNEALRLLDGIVQLSAADRAVNT
FT                   PPGSPSPGTRYIVGGAPTGEWAGWDDSIALWADGSWFRMIPKPGWTCWVEDEGMFYVFD
FT                   GSGWVTLASTLGL"
     MANSANLALP YLAASQAQKH VTHNEALRLL DGIVQLSAAD RAVNTPPGSP SPGTRYIVGG        60
     APTGEWAGWD DSIALWADGS WFRMIPKPGW TCWVEDEGMF YVFDGSGWVT LASTLGL          117
//

If you have problems or comments...

PBIL Back to PBIL home page