(data stored in ACNUC7421 zone)

EMBL: CP000489.PE267

CP000489.PE267       Location/Qualifiers
FT   CDS             complement(245625..249644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0270"
FT                   /product="gene transfer agent (GTA) like protein"
FT                   /note="KEGG: nwi:Nwi_0792 gene transfer agent (GTA) like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68384"
FT                   /db_xref="InterPro:IPR025195"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP0"
FT                   /protein_id="ABL68384.1"
FT                   /translation="MATLILGAAGTALGGAMAGTVFTAFGTAVTGAMIGGAIGSMAGSM
FT                   VDAWIIQSMMPGQKFEGQRLDAQRITSSTEGTVIPRVFGAARIGGNVIWATDFREEVTT
FT                   TRQGGKGGGGGVETTEYTYYASFAIAICEGQIGGIGRVWADGELLDMTNVTMRVYRGGE
FT                   GQQPDPLISSLMGADRTPAYRGTAYVVFEDMLLTDFGNRIPQLTFEVFRPLAHADSIEG
FT                   LARAVTLFPAAGEFGYSTQVVRTVAGVLVPINSSESGEFVNSNAAEGRTDFRVSLDRLD
FT                   DIAPNVMSVSLSVPWFGNDLRCGNCLLKPGIEHEQRNTTPISWSVNGITRGLFGSGAHL
FT                   VSRDGQNRPNFGGTPADVSVVQAIKALKNRGKRVTFYPSILMDIPAGNSLPNPYSHNAA
FT                   SVGQPAFPWRGRITCSPAPGFAGTVDKTTDATAQIAAFFGSAAAGDFSVSDESVSWTGG
FT                   EDWGYRRMILHYAYLCAAAGGVDTFLIGSELRGLTQLRNNATTGYNVVARLRTLAADVR
FT                   SILGPGTKISYAADWSEYFGHHPSDGTGDVFFHLDPLWADSNVDFVGIDNYMPLSDWRD
FT                   GWDHLDAQAGAGSIYDLGYLRGNVEGGEGYDWFYASDAARNNQARTPITDAAAGKPWVF
FT                   RYKDIRAWWSNQHRNRPGGVEQGGATAWVPQSKPIRFTGLGCPAVDRGSNQPAVSFDPK
FT                   SSESALPHFSRGWRDDSNQRAYIEAMLGYWADSTNNPQSSVYAGRMVESDECAVWAWDT
FT                   RPYPHFPALTDVWVDGENWRLGHWMTGRLGSVSLRALVRALCKEAGLADSQFDVTGLHD
FT                   AVEGYCITSIESPKSSIAMLARHFGFDACETGGLIRFVSRGRAPAGSVTTADLVRRGEG
FT                   GGEVIEMVRGQETEIPQALKWQVARNDEEYDGVMVEARRATVDSTRIAAESFSIVVPPE
FT                   EADRRCQRALQEAWVSRERATFSLPPSRLALDPTDVLTLEHDGRGYEYRLMQIGDAEAR
FT                   TIDSVRQDREAYDLPPAVTRRAHLSRPLPYDAPTTIFLDLPLLQSSQQAHRPLLAATAA
FT                   RWPGQMAVYRSEDENEGFTLLTTFNRRARIGSLAFPLHSGPVDRFDHGNELWIDLAWGT
FT                   LVSVSEQQLFSGANAFAIETAPGVWEIVQAANAELVSPGRYRLTKLLRGVRGTEWAMTS
FT                   VVASGATVVMLDEAVIELPISAEDVGVPWYWRVGPASKTISDASYRQAQFTPRAIGLEP
FT                   FAGVHAVQPYRRGRAVGDLTIEWIRRSRALAADIWGNGEVPLGEESPAYEVDILDGAAV
FT                   KRTLSSTTTSVVYTGAQQTADWGAPLAPGDSLRVDIYQVAPVAGRGIAYSETLFF"
     MATLILGAAG TALGGAMAGT VFTAFGTAVT GAMIGGAIGS MAGSMVDAWI IQSMMPGQKF        60
     EGQRLDAQRI TSSTEGTVIP RVFGAARIGG NVIWATDFRE EVTTTRQGGK GGGGGVETTE       120
     YTYYASFAIA ICEGQIGGIG RVWADGELLD MTNVTMRVYR GGEGQQPDPL ISSLMGADRT       180
     PAYRGTAYVV FEDMLLTDFG NRIPQLTFEV FRPLAHADSI EGLARAVTLF PAAGEFGYST       240
     QVVRTVAGVL VPINSSESGE FVNSNAAEGR TDFRVSLDRL DDIAPNVMSV SLSVPWFGND       300
     LRCGNCLLKP GIEHEQRNTT PISWSVNGIT RGLFGSGAHL VSRDGQNRPN FGGTPADVSV       360
     VQAIKALKNR GKRVTFYPSI LMDIPAGNSL PNPYSHNAAS VGQPAFPWRG RITCSPAPGF       420
     AGTVDKTTDA TAQIAAFFGS AAAGDFSVSD ESVSWTGGED WGYRRMILHY AYLCAAAGGV       480
     DTFLIGSELR GLTQLRNNAT TGYNVVARLR TLAADVRSIL GPGTKISYAA DWSEYFGHHP       540
     SDGTGDVFFH LDPLWADSNV DFVGIDNYMP LSDWRDGWDH LDAQAGAGSI YDLGYLRGNV       600
     EGGEGYDWFY ASDAARNNQA RTPITDAAAG KPWVFRYKDI RAWWSNQHRN RPGGVEQGGA       660
     TAWVPQSKPI RFTGLGCPAV DRGSNQPAVS FDPKSSESAL PHFSRGWRDD SNQRAYIEAM       720
     LGYWADSTNN PQSSVYAGRM VESDECAVWA WDTRPYPHFP ALTDVWVDGE NWRLGHWMTG       780
     RLGSVSLRAL VRALCKEAGL ADSQFDVTGL HDAVEGYCIT SIESPKSSIA MLARHFGFDA       840
     CETGGLIRFV SRGRAPAGSV TTADLVRRGE GGGEVIEMVR GQETEIPQAL KWQVARNDEE       900
     YDGVMVEARR ATVDSTRIAA ESFSIVVPPE EADRRCQRAL QEAWVSRERA TFSLPPSRLA       960
     LDPTDVLTLE HDGRGYEYRL MQIGDAEART IDSVRQDREA YDLPPAVTRR AHLSRPLPYD      1020
     APTTIFLDLP LLQSSQQAHR PLLAATAARW PGQMAVYRSE DENEGFTLLT TFNRRARIGS      1080
     LAFPLHSGPV DRFDHGNELW IDLAWGTLVS VSEQQLFSGA NAFAIETAPG VWEIVQAANA      1140
     ELVSPGRYRL TKLLRGVRGT EWAMTSVVAS GATVVMLDEA VIELPISAED VGVPWYWRVG      1200
     PASKTISDAS YRQAQFTPRA IGLEPFAGVH AVQPYRRGRA VGDLTIEWIR RSRALAADIW      1260
     GNGEVPLGEE SPAYEVDILD GAAVKRTLSS TTTSVVYTGA QQTADWGAPL APGDSLRVDI      1320
     YQVAPVAGRG IAYSETLFF                                                   1339
//

If you have problems or comments...

PBIL Back to PBIL home page