(data stored in ACNUC7421 zone)

EMBL: CP000489.PE268

CP000489.PE268       Location/Qualifiers
FT   CDS             complement(249649..250086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0271"
FT                   /product="putative phage cell wall peptidase, NlpC/P60
FT                   family"
FT                   /note="TIGRFAM: putative phage cell wall peptidase,
FT                   NlpC/P60 family; PFAM: NLP/P60 protein; KEGG: sil:SPO2729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68385"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR011929"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP1"
FT                   /protein_id="ABL68385.1"
FT                   /translation="MSADPAIVIAAARAWLGTPYHDQASTIGAGCDCLGLARGVWRQIV
FT                   GHEPTEIPPYGRGWGEIGQREVLAEGARQWMIQIDPLEAGPGSVVLFRMRENGIAKHVG
FT                   ILTGPDSFIHSYERLGVIEQPLTTAWQRRIAFAFLYPNPES"
     MSADPAIVIA AARAWLGTPY HDQASTIGAG CDCLGLARGV WRQIVGHEPT EIPPYGRGWG        60
     EIGQREVLAE GARQWMIQID PLEAGPGSVV LFRMRENGIA KHVGILTGPD SFIHSYERLG       120
     VIEQPLTTAW QRRIAFAFLY PNPES                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page