(data stored in ACNUC7421 zone)

EMBL: CP000489.PE27

CP000489.PE27        Location/Qualifiers
FT   CDS             22991..23962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0027"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: rsp:RSP_2583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68144"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022456"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY00"
FT                   /protein_id="ABL68144.1"
FT                   /translation="MKVSTAILTSALCLGFALPAAANRVFVSNEKGNDVTVLDSETLEV
FT                   IGTYPVGARPRGITISPDGKELYVCASDDDLVRVFNPETMEEMHTLPSGPDPELFVLHP
FT                   SGNPLYIANEDDNLVTVVDTQTHKVLAEIPVGVEPEGMGVSPDGKVVINTSETTNMAHF
FT                   IDSESFEIFANVLVDSRPRFAQFNDAGTKLYVSSEIGGTVSVIDPATQEITRKISFEIP
FT                   GVLPEAIQPVGVRVTSDGSKVFVALGPANRVAVINGETDEVEDYLLVGQRVWQMAFTPD
FT                   EKYLFTTNGNSNDVSVIDVAALTVVKSVPVGQQPWGVVVAPN"
     MKVSTAILTS ALCLGFALPA AANRVFVSNE KGNDVTVLDS ETLEVIGTYP VGARPRGITI        60
     SPDGKELYVC ASDDDLVRVF NPETMEEMHT LPSGPDPELF VLHPSGNPLY IANEDDNLVT       120
     VVDTQTHKVL AEIPVGVEPE GMGVSPDGKV VINTSETTNM AHFIDSESFE IFANVLVDSR       180
     PRFAQFNDAG TKLYVSSEIG GTVSVIDPAT QEITRKISFE IPGVLPEAIQ PVGVRVTSDG       240
     SKVFVALGPA NRVAVINGET DEVEDYLLVG QRVWQMAFTP DEKYLFTTNG NSNDVSVIDV       300
     AALTVVKSVP VGQQPWGVVV APN                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page