(data stored in ACNUC7421 zone)

EMBL: CP000489.PE270

CP000489.PE270       Location/Qualifiers
FT   CDS             complement(250964..251590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68387"
FT                   /db_xref="InterPro:IPR011740"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYP3"
FT                   /protein_id="ABL68387.1"
FT                   /translation="MAFHEIRFPDNISRGARGGPRRMTQVVELSSGDEERNASWANSRR
FT                   VYDVSYGIRNADQLAEVVSFFEARNGRLYGFRFKDWSDYKSCSPMQVSHPADMALGVGD
FT                   GTRTEFQLRKFYISGSQSWTRIITKPVADTVRVAVNGVEQLSGWTVDTTTGVVTFANPP
FT                   AAGQQVRAGFQFDVPVRFDTDQLDLILDIERLGSIPSIPLIEVRR"
     MAFHEIRFPD NISRGARGGP RRMTQVVELS SGDEERNASW ANSRRVYDVS YGIRNADQLA        60
     EVVSFFEARN GRLYGFRFKD WSDYKSCSPM QVSHPADMAL GVGDGTRTEF QLRKFYISGS       120
     QSWTRIITKP VADTVRVAVN GVEQLSGWTV DTTTGVVTFA NPPAAGQQVR AGFQFDVPVR       180
     FDTDQLDLIL DIERLGSIPS IPLIEVRR                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page