(data stored in ACNUC7421 zone)

EMBL: CP000489.PE277

CP000489.PE277       Location/Qualifiers
FT   CDS             259188..259973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0280"
FT                   /product="hydroxyectoine ABC transporter ATP-binding
FT                   protein / ectoine ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMb20427 putative amino acid ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68394"
FT                   /db_xref="GOA:A1AYQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014343"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ0"
FT                   /protein_id="ABL68394.1"
FT                   /translation="MDQPIIRIQNLRKSFGTLTVIDGLNFDVMKGEKLALIGPSGSGKT
FT                   TILRILMTLEDISGGRIEVCGEPLYHMQRSGAEVPADEAHLHKMRRHIGMVFQHFNLFP
FT                   HKSVLQNITLAPMLTKGEARAVAEKRARELLDMVGLSDKADYMPSQLSGGQKQRVAIAR
FT                   ALALQPQIMLFDEVTSALDPELVEEVLEVMKRLAAETDMTMLLVTHEMGFAHDFADRVL
FT                   FFDKGRIVEQGPPAQIFTAPQEDRTKSFLRKIIAAGQRV"
     MDQPIIRIQN LRKSFGTLTV IDGLNFDVMK GEKLALIGPS GSGKTTILRI LMTLEDISGG        60
     RIEVCGEPLY HMQRSGAEVP ADEAHLHKMR RHIGMVFQHF NLFPHKSVLQ NITLAPMLTK       120
     GEARAVAEKR ARELLDMVGL SDKADYMPSQ LSGGQKQRVA IARALALQPQ IMLFDEVTSA       180
     LDPELVEEVL EVMKRLAAET DMTMLLVTHE MGFAHDFADR VLFFDKGRIV EQGPPAQIFT       240
     APQEDRTKSF LRKIIAAGQR V                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page