(data stored in ACNUC7421 zone)

EMBL: CP000489.PE281

CP000489.PE281       Location/Qualifiers
FT   CDS             262191..262934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0284"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: sme:SMb20431
FT                   hypothetical arylmalonate decarboxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68398"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ4"
FT                   /protein_id="ABL68398.1"
FT                   /translation="MTVLSVPVALDERPLPRRVGLVTLATDHTTEVDFSALPAHGVGVY
FT                   ATRIPFANPVTPETLAAMARDVTAAAALILPDEELDAVVYSCTSASVVIGDQAVRDAIR
FT                   LGKPSAEPITPISAGFAALRALEAGRITLLTPYTPRTTQPMAECFEAGGFVLQGVSCLN
FT                   LTDDREMARISHATIVEAARAALAPGSQALFVACTAVRAAAIIDRIEDALGVPVVSANS
FT                   ATLWAAARACGISGPVAPGQLMRLA"
     MTVLSVPVAL DERPLPRRVG LVTLATDHTT EVDFSALPAH GVGVYATRIP FANPVTPETL        60
     AAMARDVTAA AALILPDEEL DAVVYSCTSA SVVIGDQAVR DAIRLGKPSA EPITPISAGF       120
     AALRALEAGR ITLLTPYTPR TTQPMAECFE AGGFVLQGVS CLNLTDDREM ARISHATIVE       180
     AARAALAPGS QALFVACTAV RAAAIIDRIE DALGVPVVSA NSATLWAAAR ACGISGPVAP       240
     GQLMRLA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page