(data stored in ACNUC7421 zone)

EMBL: CP000489.PE283

CP000489.PE283       Location/Qualifiers
FT   CDS             263884..264861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0286"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: sme:SMb20433
FT                   putative cyclodeaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68400"
FT                   /db_xref="GOA:A1AYQ6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR014334"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ6"
FT                   /protein_id="ABL68400.1"
FT                   /translation="MRPPVTILTETDLRALVPLDAKAVACIRDAFVALATKPVAMPPIL
FT                   RLDIPEHRGEVDVKTAYVPGLTHFAIKISPGFFGNPALGLPSTNGMMVVLSSRTGLVEA
FT                   LLLDNGYLTDVRTAAAGAVAADALARPDAATAAILGAGMQARMQLQALALVRRLTGVRV
FT                   WARDPAKAQAFAAEMTAILRIPVTAGASVAEAARDADLVVTTTPSESPILSAADIAPGT
FT                   HVTAMGSDAGHKNEIAPDLIAAAHYVADRLSQTRTLGELHHSPLVGRDFPELGQILAGQ
FT                   RPGRTDPAQITLADLTGTGIQDTAIATLALARAGKAGAGRTFTL"
     MRPPVTILTE TDLRALVPLD AKAVACIRDA FVALATKPVA MPPILRLDIP EHRGEVDVKT        60
     AYVPGLTHFA IKISPGFFGN PALGLPSTNG MMVVLSSRTG LVEALLLDNG YLTDVRTAAA       120
     GAVAADALAR PDAATAAILG AGMQARMQLQ ALALVRRLTG VRVWARDPAK AQAFAAEMTA       180
     ILRIPVTAGA SVAEAARDAD LVVTTTPSES PILSAADIAP GTHVTAMGSD AGHKNEIAPD       240
     LIAAAHYVAD RLSQTRTLGE LHHSPLVGRD FPELGQILAG QRPGRTDPAQ ITLADLTGTG       300
     IQDTAIATLA LARAGKAGAG RTFTL                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page