(data stored in ACNUC7421 zone)

EMBL: CP000489.PE284

CP000489.PE284       Location/Qualifiers
FT   CDS             264873..266054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0287"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: sme:SMb20434 putative
FT                   hydrolasepeptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68401"
FT                   /db_xref="GOA:A1AYQ7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR014335"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYQ7"
FT                   /protein_id="ABL68401.1"
FT                   /translation="MTDVALKFTREEYAQRLAKTRRAMEEKGVDLLIVTDPSNMNWLTG
FT                   YDGWSFYVHQCVVVPPEGEPIWYGRGQDANGAKLTAYLKPENIVGYPDHYVQNPAMHPM
FT                   DHLSGILRDKGWGAKRIGVEMDNYWFTAAAFASLVANLPDARLTDCTALVNWQRAVKSP
FT                   QEIAYMRNAARIVEAMHARILDKVQVGMRKCDLVAEIYDAGTRGVDGIGGDYPAIVPLL
FT                   PSGRDASAPHLTWDDKPMKAGEGTFFEIAGCYHRYHVPLSRTVFLGKPTQAFLDAEKAT
FT                   LEGMEAGLAAAKPGNTCEDIAKGFFDVLAKYGIVKDNRTGYGIGVSYPPDWGERTMSLR
FT                   PGDRTVLQPGMTFHFMTGLWLEDMGLEITESILITETGVECLADVPRQLFVKD"
     MTDVALKFTR EEYAQRLAKT RRAMEEKGVD LLIVTDPSNM NWLTGYDGWS FYVHQCVVVP        60
     PEGEPIWYGR GQDANGAKLT AYLKPENIVG YPDHYVQNPA MHPMDHLSGI LRDKGWGAKR       120
     IGVEMDNYWF TAAAFASLVA NLPDARLTDC TALVNWQRAV KSPQEIAYMR NAARIVEAMH       180
     ARILDKVQVG MRKCDLVAEI YDAGTRGVDG IGGDYPAIVP LLPSGRDASA PHLTWDDKPM       240
     KAGEGTFFEI AGCYHRYHVP LSRTVFLGKP TQAFLDAEKA TLEGMEAGLA AAKPGNTCED       300
     IAKGFFDVLA KYGIVKDNRT GYGIGVSYPP DWGERTMSLR PGDRTVLQPG MTFHFMTGLW       360
     LEDMGLEITE SILITETGVE CLADVPRQLF VKD                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page