(data stored in ACNUC7421 zone)

EMBL: CP000489.PE288

CP000489.PE288       Location/Qualifiers
FT   CDS             269891..271033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0291"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   csa:Csal_2340 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68405"
FT                   /db_xref="GOA:A1AYR1"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR1"
FT                   /protein_id="ABL68405.1"
FT                   /translation="MTAIPETMCAMVLTGHGGTERLEWREDWPVPRPGPGEVLVRITAC
FT                   AKNNTDRKVREGRYSTADDGAVTSFAMAGNTLSFPRIQGADVVGHVVAVGQGVPTDRIG
FT                   ERGLLDFNIYPDARDDLNLAPDYFGHGADGGFAEYGCFPSEQFHAIANPALGDAELATL
FT                   GMCSWQTGYRMLTSAGVGAGEHVLVTGASGGVGTALLQLCRVIGAIPHAVASAGKAEAL
FT                   HALGAETVIDRNAVGDWPSAIDRATGGATIDAVMDLVGGEMTVPLIQAMCRDMRRRTTP
FT                   PRLSIAGASAGNVTALPWTLIYLNQVRIFGVSHGTRAEARQLIGWIGENRLKPVLAGIM
FT                   PLSRLREAERLFVERGRDFIGKLVIVPDRVVAEQGLETMA"
     MTAIPETMCA MVLTGHGGTE RLEWREDWPV PRPGPGEVLV RITACAKNNT DRKVREGRYS        60
     TADDGAVTSF AMAGNTLSFP RIQGADVVGH VVAVGQGVPT DRIGERGLLD FNIYPDARDD       120
     LNLAPDYFGH GADGGFAEYG CFPSEQFHAI ANPALGDAEL ATLGMCSWQT GYRMLTSAGV       180
     GAGEHVLVTG ASGGVGTALL QLCRVIGAIP HAVASAGKAE ALHALGAETV IDRNAVGDWP       240
     SAIDRATGGA TIDAVMDLVG GEMTVPLIQA MCRDMRRRTT PPRLSIAGAS AGNVTALPWT       300
     LIYLNQVRIF GVSHGTRAEA RQLIGWIGEN RLKPVLAGIM PLSRLREAER LFVERGRDFI       360
     GKLVIVPDRV VAEQGLETMA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page