(data stored in ACNUC7421 zone)

EMBL: CP000489.PE29

CP000489.PE29        Location/Qualifiers
FT   CDS             24593..25312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0029"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_2586 ABC multidrug efflux transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68146"
FT                   /db_xref="GOA:A1AY02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022467"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY02"
FT                   /protein_id="ABL68146.1"
FT                   /translation="MPQDALSIQHVSHSFGRVPALKDVSLTVPRGGFTALLGVNGAGKT
FT                   TLFSLITRLYDNRSGRIEVAGHDLRRQPGAALARLGVVFQSRALDADLTVAQNLEYHAA
FT                   LHGIPRREARARSVEVLAQVDLSDRLHARVSALSGGQSRRAEIARALIHRPEILLLDEA
FT                   TVGLDVKSRAEVVALTRELVRGGVSALWATHILDEIRPEDGLVILHKGEVLARGNAGEI
FT                   GGDDLTATFLRLTGEPA"
     MPQDALSIQH VSHSFGRVPA LKDVSLTVPR GGFTALLGVN GAGKTTLFSL ITRLYDNRSG        60
     RIEVAGHDLR RQPGAALARL GVVFQSRALD ADLTVAQNLE YHAALHGIPR REARARSVEV       120
     LAQVDLSDRL HARVSALSGG QSRRAEIARA LIHRPEILLL DEATVGLDVK SRAEVVALTR       180
     ELVRGGVSAL WATHILDEIR PEDGLVILHK GEVLARGNAG EIGGDDLTAT FLRLTGEPA        239
//

If you have problems or comments...

PBIL Back to PBIL home page