(data stored in ACNUC7421 zone)

EMBL: CP000489.PE290

CP000489.PE290       Location/Qualifiers
FT   CDS             complement(272403..272990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68407"
FT                   /db_xref="GOA:A1AYR3"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR3"
FT                   /protein_id="ABL68407.1"
FT                   /translation="MGSILHEPPSDDHAESIGIPGHPRPMRRGCSWHRPGGPLHARCLR
FT                   DGDEGQAGPDRTTPPRHGWRAEARPLRDALRFPPAPFRRRPPFHQKSRTMLKKLTPDSV
FT                   SRSDRDQDRGFPLGIVVLASLAAVAATALAWLMGWGLPWLVATYCLTGSVALLGLAWHK
FT                   ASRPDSEERYENADAAETGHAPRRAAVSGRPR"
     MGSILHEPPS DDHAESIGIP GHPRPMRRGC SWHRPGGPLH ARCLRDGDEG QAGPDRTTPP        60
     RHGWRAEARP LRDALRFPPA PFRRRPPFHQ KSRTMLKKLT PDSVSRSDRD QDRGFPLGIV       120
     VLASLAAVAA TALAWLMGWG LPWLVATYCL TGSVALLGLA WHKASRPDSE ERYENADAAE       180
     TGHAPRRAAV SGRPR                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page