(data stored in ACNUC7421 zone)

EMBL: CP000489.PE291

CP000489.PE291       Location/Qualifiers
FT   CDS             complement(273336..275105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0294"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   sil:SPO1617 type I secretion target repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68408"
FT                   /db_xref="GOA:A1AYR4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR4"
FT                   /protein_id="ABL68408.1"
FT                   /translation="MTDPTNNQPLNTAAMAFSSSAQPDGIVDGTDGDDYMVPGYVDHQG
FT                   DVVDGADGVNDWINAGAGNDTVNGGAGNDTIEGGEGDDLLRGNAGHDIIRGDAGNDTIN
FT                   GDAGNDTIEGGEGDDLLRGDAGDDVLRGGEGNDTFNGGIGNDTIEGEEGDDLLRGDDGD
FT                   DLLLGGVGSDTLNGGLGNDTLDGGDDDDLLRGDDGNDLLLGGAGNDTLNGGNGDDTLEG
FT                   GEGDDLLRGDAGHDLLQGGDGNDTLEGGQGNDVLEGGDGDDSLIGGPGADTMTGGAGND
FT                   RFVVSGGGDLITDFDAVTGIGDGQSDNNDFVDLNAFYNGTTLAAWNAANPHQTYASPES
FT                   WMQADQADGVLDAVGGLRIQDGTGNSVLGSQLTTENTGVLCFLRGTLIKTADGEVPVEQ
FT                   LEPGTKVMTLDHGCKALRWIGKRVLSAEELAAQPKLRPIRIRAEALGERLPERDLIVSP
FT                   QHRVLLRSVVARRMVGEAEVLLAARHLIGLDGIEVVEDMQEVEYWHFMFDRHEVVFSNG
FT                   APTESLFTGPEAMKALGPEARHEILTLFPQLAQPEPQQPAAARLLMRGRQGRHLVQRLV
FT                   ANGKQPFNWGKVG"
     MTDPTNNQPL NTAAMAFSSS AQPDGIVDGT DGDDYMVPGY VDHQGDVVDG ADGVNDWINA        60
     GAGNDTVNGG AGNDTIEGGE GDDLLRGNAG HDIIRGDAGN DTINGDAGND TIEGGEGDDL       120
     LRGDAGDDVL RGGEGNDTFN GGIGNDTIEG EEGDDLLRGD DGDDLLLGGV GSDTLNGGLG       180
     NDTLDGGDDD DLLRGDDGND LLLGGAGNDT LNGGNGDDTL EGGEGDDLLR GDAGHDLLQG       240
     GDGNDTLEGG QGNDVLEGGD GDDSLIGGPG ADTMTGGAGN DRFVVSGGGD LITDFDAVTG       300
     IGDGQSDNND FVDLNAFYNG TTLAAWNAAN PHQTYASPES WMQADQADGV LDAVGGLRIQ       360
     DGTGNSVLGS QLTTENTGVL CFLRGTLIKT ADGEVPVEQL EPGTKVMTLD HGCKALRWIG       420
     KRVLSAEELA AQPKLRPIRI RAEALGERLP ERDLIVSPQH RVLLRSVVAR RMVGEAEVLL       480
     AARHLIGLDG IEVVEDMQEV EYWHFMFDRH EVVFSNGAPT ESLFTGPEAM KALGPEARHE       540
     ILTLFPQLAQ PEPQQPAAAR LLMRGRQGRH LVQRLVANGK QPFNWGKVG                   589
//

If you have problems or comments...

PBIL Back to PBIL home page