(data stored in ACNUC7421 zone)

EMBL: CP000489.PE293

CP000489.PE293       Location/Qualifiers
FT   CDS             complement(276190..278148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0296"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: rsp:RSP_3056 TonB dependent-iron
FT                   siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68410"
FT                   /db_xref="GOA:A1AYR6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR6"
FT                   /protein_id="ABL68410.1"
FT                   /translation="MAAPFTPRLILVAGAAAALALPALAQETVVLLDPITLRALDADGS
FT                   AADRGASQYVAAAELERARMGDLKDLFTGIASVSVGGAIPVAQKIFINGVDMLNLSVTV
FT                   DGVEQNNRAFHHVSANAIDPGLLKFVRVDAGVAAADAGPHAVAGAVVMETVDAADILED
FT                   GRSFGGNVRLSYGDNGRTFGRAATLAGQMGGFEWLGYLKSATGDDYQAGGGQTIRGSAA
FT                   DLQSVLLKLAHETPGGHRIELSGQRLRDDTLRPYRANIGHIEGGAPLPELRRYDTTRSS
FT                   WSLSYENTQAGGLWDPRFVIGRSESRVHVDQPTVMPPYVSKGDSDTFSAKLENRFHLSD
FT                   ANSVTAGIDWYDRSSTYSDPFGGLDENARNIGLYAQARLEPVERLDLSFGLRWDRQDFT
FT                   GTSGWKDTNSGFSGNASLAYGLTDALVLRAGASTVFGGIAIEDNYIFNGAWDYDTLRPA
FT                   RARNYTLGFDYEAGDLRLDGELFLTQVDNARGGTYRGIENFDFESRGYNLGLGYGWNGG
FT                   YLRASISDSRVSVNGNPASSYEALDFGAPLGRVFSIEAQHTPQGSAFTYGGSIEAAAKY
FT                   DRIEGDSDRTIPGYAVLNLFAEYAPEQVEALVLRAEVANLFDKDYADRATYGGDYATVT
FT                   PLREPGRTFSLVATKRF"
     MAAPFTPRLI LVAGAAAALA LPALAQETVV LLDPITLRAL DADGSAADRG ASQYVAAAEL        60
     ERARMGDLKD LFTGIASVSV GGAIPVAQKI FINGVDMLNL SVTVDGVEQN NRAFHHVSAN       120
     AIDPGLLKFV RVDAGVAAAD AGPHAVAGAV VMETVDAADI LEDGRSFGGN VRLSYGDNGR       180
     TFGRAATLAG QMGGFEWLGY LKSATGDDYQ AGGGQTIRGS AADLQSVLLK LAHETPGGHR       240
     IELSGQRLRD DTLRPYRANI GHIEGGAPLP ELRRYDTTRS SWSLSYENTQ AGGLWDPRFV       300
     IGRSESRVHV DQPTVMPPYV SKGDSDTFSA KLENRFHLSD ANSVTAGIDW YDRSSTYSDP       360
     FGGLDENARN IGLYAQARLE PVERLDLSFG LRWDRQDFTG TSGWKDTNSG FSGNASLAYG       420
     LTDALVLRAG ASTVFGGIAI EDNYIFNGAW DYDTLRPARA RNYTLGFDYE AGDLRLDGEL       480
     FLTQVDNARG GTYRGIENFD FESRGYNLGL GYGWNGGYLR ASISDSRVSV NGNPASSYEA       540
     LDFGAPLGRV FSIEAQHTPQ GSAFTYGGSI EAAAKYDRIE GDSDRTIPGY AVLNLFAEYA       600
     PEQVEALVLR AEVANLFDKD YADRATYGGD YATVTPLREP GRTFSLVATK RF               652
//

If you have problems or comments...

PBIL Back to PBIL home page