(data stored in ACNUC7421 zone)

EMBL: CP000489.PE296

CP000489.PE296       Location/Qualifiers
FT   CDS             complement(279955..280911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0299"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4489 ferrichrome ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68413"
FT                   /db_xref="GOA:A1AYR9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYR9"
FT                   /protein_id="ABL68413.1"
FT                   /translation="MTRLAAAVLVTAGLALASLFVGVSNVSLRGILAGQELDWLVLVES
FT                   RLPRMLALLLSGASMAIAGLLTQIVIRNRFVEPANTGTMESAGLGLLVMTLVAPGAPVI
FT                   AKMAAGAGFAMAGTALFLAILRRVPLRDPMLVPLVGILLSGVIYAGTAFVAYRFDLIQT
FT                   VLAWTQGDLSGVLRGRYELLWLGATLAAVAWLAADRFTVAGLGRDIASSLGLAHGRVVA
FT                   LGLTIVSLVTAVVVVTVGMIPFLGLIVPNIVSLALGDNMRRAVPWVAVSGAALVLACDI
FT                   LGRVIRAPYEVPLGTVLGVLGSAVFLVLILRSRDRAA"
     MTRLAAAVLV TAGLALASLF VGVSNVSLRG ILAGQELDWL VLVESRLPRM LALLLSGASM        60
     AIAGLLTQIV IRNRFVEPAN TGTMESAGLG LLVMTLVAPG APVIAKMAAG AGFAMAGTAL       120
     FLAILRRVPL RDPMLVPLVG ILLSGVIYAG TAFVAYRFDL IQTVLAWTQG DLSGVLRGRY       180
     ELLWLGATLA AVAWLAADRF TVAGLGRDIA SSLGLAHGRV VALGLTIVSL VTAVVVVTVG       240
     MIPFLGLIVP NIVSLALGDN MRRAVPWVAV SGAALVLACD ILGRVIRAPY EVPLGTVLGV       300
     LGSAVFLVLI LRSRDRAA                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page