(data stored in ACNUC7421 zone)

EMBL: CP000489.PE300

CP000489.PE300       Location/Qualifiers
FT   CDS             284436..284876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0303"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   sme:SMa1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68417"
FT                   /db_xref="GOA:A1AYS3"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS3"
FT                   /protein_id="ABL68417.1"
FT                   /translation="MTMRSFPDRVRHALMFEIIGLAIITPAAAWLYDKPMLDMGVVGVG
FT                   AATLATVWTFVFNLGFDHAMRRWVGHVHKAVHHRLLHTVLFEFGLLVMLLPPMAWYLGM
FT                   TLWQTLLLDLFIVAFYLVYNFVFNVIYDRVFPLPEMPRGQPA"
     MTMRSFPDRV RHALMFEIIG LAIITPAAAW LYDKPMLDMG VVGVGAATLA TVWTFVFNLG        60
     FDHAMRRWVG HVHKAVHHRL LHTVLFEFGL LVMLLPPMAW YLGMTLWQTL LLDLFIVAFY       120
     LVYNFVFNVI YDRVFPLPEM PRGQPA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page