(data stored in ACNUC7421 zone)

EMBL: CP000489.PE305

CP000489.PE305       Location/Qualifiers
FT   CDS             complement(288547..289488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0308"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   sme:SMb20724 putative tricarboxylic transport membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68422"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS8"
FT                   /protein_id="ABL68422.1"
FT                   /translation="MKQFVLASLFAAATALPAMADYTIIAPANPGGGWDQTARTMQAVM
FT                   QEEGISKSVQVQNVPGAGGTIGLAQFASQNKGNPDALIVGGYVMVGAILTNNSPVSLKD
FT                   VTPIARLTGEYEAIVVPAASPIQDVAGLIEALKADPGAVSWAGGSAGGTDHIAVGLIAK
FT                   AAGVDPTKINYIAYSGGGEALAAILGNQVTAGISSLGEFEAQIQAGTLRLLAVTAPERL
FT                   EGVDAPTLQEAGLDVVLENWRMVAAAPGLSDEQKAKVTADIEKMAKSENWQKQLSDKGW
FT                   MDTYLAGPEFEAQLEQDVTSTEAILKDIGLVK"
     MKQFVLASLF AAATALPAMA DYTIIAPANP GGGWDQTART MQAVMQEEGI SKSVQVQNVP        60
     GAGGTIGLAQ FASQNKGNPD ALIVGGYVMV GAILTNNSPV SLKDVTPIAR LTGEYEAIVV       120
     PAASPIQDVA GLIEALKADP GAVSWAGGSA GGTDHIAVGL IAKAAGVDPT KINYIAYSGG       180
     GEALAAILGN QVTAGISSLG EFEAQIQAGT LRLLAVTAPE RLEGVDAPTL QEAGLDVVLE       240
     NWRMVAAAPG LSDEQKAKVT ADIEKMAKSE NWQKQLSDKG WMDTYLAGPE FEAQLEQDVT       300
     STEAILKDIG LVK                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page