(data stored in ACNUC7421 zone)

EMBL: CP000489.PE306

CP000489.PE306       Location/Qualifiers
FT   CDS             complement(289661..290758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0309"
FT                   /product="periplasmic iron-binding protein"
FT                   /note="KEGG: atc:AGR_C_4480 periplasmic iron-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68423"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYS9"
FT                   /protein_id="ABL68423.1"
FT                   /translation="MAKSPIMRLIARLMPAIATALALWPGPASAQVTLFPAPAGDGREL
FT                   SVYSSLDDDLAAPLVAAFQNLHPGVTVRYENLLTTELHDRIVAETQAGGGTADFAFSSA
FT                   MDLQVKLANDGFARPVETPHTRGWPGWANWRDTAYALTFEPAVFAYHKPSFAGREPPAT
FT                   RADLMQWMAEHPDEAQGRIGTYDVSRSGVGYLFLARDQELYPGIWSVVQAMGRAGVQQF
FT                   PTSAELLERIADGRLRLGYNLLGSYASDWARRHPDVGVILPRDFTVVVSRVALVPAAAR
FT                   QPGLGADFLAFLMSPEGQGLLSRTLRLSAVSLEVAGQPGPAGGMQDLAGLRLKPVPVSP
FT                   GLLAYLDQATRAKLLARWNKALAGE"
     MAKSPIMRLI ARLMPAIATA LALWPGPASA QVTLFPAPAG DGRELSVYSS LDDDLAAPLV        60
     AAFQNLHPGV TVRYENLLTT ELHDRIVAET QAGGGTADFA FSSAMDLQVK LANDGFARPV       120
     ETPHTRGWPG WANWRDTAYA LTFEPAVFAY HKPSFAGREP PATRADLMQW MAEHPDEAQG       180
     RIGTYDVSRS GVGYLFLARD QELYPGIWSV VQAMGRAGVQ QFPTSAELLE RIADGRLRLG       240
     YNLLGSYASD WARRHPDVGV ILPRDFTVVV SRVALVPAAA RQPGLGADFL AFLMSPEGQG       300
     LLSRTLRLSA VSLEVAGQPG PAGGMQDLAG LRLKPVPVSP GLLAYLDQAT RAKLLARWNK       360
     ALAGE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page