(data stored in ACNUC7421 zone)

EMBL: CP000489.PE309

CP000489.PE309       Location/Qualifiers
FT   CDS             293052..294146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0312"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475; KEGG:
FT                   rsp:RSP_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68426"
FT                   /db_xref="GOA:A1AYT2"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT2"
FT                   /protein_id="ABL68426.1"
FT                   /translation="MQQGNNPSAGGSTNGTHRPTLHYFKWSFIVTALGLALGAVLGWQT
FT                   TGTVGGTLTIFFICAVLAVLEISLSFDNAIVNANKLKEMTPKWQRRFLTWGILIAVFGM
FT                   RIVFPLLIVVIAANIGPWQAMVLAASQPDEYSRIMHDAHLPIAAFGGTFLMMVGLSFFF
FT                   DHEKDVHWVRWLEHRMQRYATVRGIEVAVVLVTVLIFSRFLEGADSQVFFHSAIWGLLT
FT                   FLLVEVLGGLLDSSQEAMQAGAKGGIGAFLYLEVLDASFSFDGVIGAFALTHNLFVIAI
FT                   GLGIGAMYVRSMTIMLVERGTLAEYRFLEHGAFYAIIALSVIMFVQPLVHIPEVITGLG
FT                   GATLIGISFWSSIRWNRKNHAVEA"
     MQQGNNPSAG GSTNGTHRPT LHYFKWSFIV TALGLALGAV LGWQTTGTVG GTLTIFFICA        60
     VLAVLEISLS FDNAIVNANK LKEMTPKWQR RFLTWGILIA VFGMRIVFPL LIVVIAANIG       120
     PWQAMVLAAS QPDEYSRIMH DAHLPIAAFG GTFLMMVGLS FFFDHEKDVH WVRWLEHRMQ       180
     RYATVRGIEV AVVLVTVLIF SRFLEGADSQ VFFHSAIWGL LTFLLVEVLG GLLDSSQEAM       240
     QAGAKGGIGA FLYLEVLDAS FSFDGVIGAF ALTHNLFVIA IGLGIGAMYV RSMTIMLVER       300
     GTLAEYRFLE HGAFYAIIAL SVIMFVQPLV HIPEVITGLG GATLIGISFW SSIRWNRKNH       360
     AVEA                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page