(data stored in ACNUC7421 zone)

EMBL: CP000489.PE31

CP000489.PE31        Location/Qualifiers
FT   CDS             26124..26714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_2588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68148"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY04"
FT                   /protein_id="ABL68148.1"
FT                   /translation="MRYLVLALCLAAGAAQAENGTDPEWPCVQRKQPNLSLGQMWSGPE
FT                   PDEAARDLARTPGIAALADRLEQRRLPLAEAEAEIAEFAKTADNQQLTALVVAIFDRIE
FT                   PHRAALIAGIARYGHKQVDLAQRIQDHRAKMEEMQKAEAPDFDAIDAEEERLDWDMRIF
FT                   QDRQQALTYVCETPVILEQRVFALARAIAAGLQ"
     MRYLVLALCL AAGAAQAENG TDPEWPCVQR KQPNLSLGQM WSGPEPDEAA RDLARTPGIA        60
     ALADRLEQRR LPLAEAEAEI AEFAKTADNQ QLTALVVAIF DRIEPHRAAL IAGIARYGHK       120
     QVDLAQRIQD HRAKMEEMQK AEAPDFDAID AEEERLDWDM RIFQDRQQAL TYVCETPVIL       180
     EQRVFALARA IAAGLQ                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page