(data stored in ACNUC7421 zone)

EMBL: CP000489.PE310

CP000489.PE310       Location/Qualifiers
FT   CDS             294237..295178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sil:SPO0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68427"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT3"
FT                   /protein_id="ABL68427.1"
FT                   /translation="MRYLLALLVVVAVAALFYWRHAQKAGAAHDDGADVQALYQAGRPL
FT                   PQGPLRVYHLGHSLVGRDMPAMLAQLAGQGHDYALQLGWGTALREHHQGREAINGFDQE
FT                   NATPHHREAHEALASGAYDAFVMTEMVRLKDAIQYKESRTYAGKWAAEAAAGNPAGQIF
FT                   LYESWHALDDQPDWLSRLPDDLETMWKPGLLWPAARAAGRPVWLIPGGQVMARLVAEAE
FT                   AKGGIAELTSREGLFARSPDGTLDTIHPNDLGVYLVALTHYAVLYGQSPVGLPHELMRA
FT                   DGSPADAPSPELARRMQEVVWEVVSTNPLTGL"
     MRYLLALLVV VAVAALFYWR HAQKAGAAHD DGADVQALYQ AGRPLPQGPL RVYHLGHSLV        60
     GRDMPAMLAQ LAGQGHDYAL QLGWGTALRE HHQGREAING FDQENATPHH REAHEALASG       120
     AYDAFVMTEM VRLKDAIQYK ESRTYAGKWA AEAAAGNPAG QIFLYESWHA LDDQPDWLSR       180
     LPDDLETMWK PGLLWPAARA AGRPVWLIPG GQVMARLVAE AEAKGGIAEL TSREGLFARS       240
     PDGTLDTIHP NDLGVYLVAL THYAVLYGQS PVGLPHELMR ADGSPADAPS PELARRMQEV       300
     VWEVVSTNPL TGL                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page