(data stored in ACNUC7421 zone)

EMBL: CP000489.PE311

CP000489.PE311       Location/Qualifiers
FT   CDS             295262..295834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0314"
FT                   /product="AmiS/UreI transporter"
FT                   /note="PFAM: AmiS/UreI transporter; KEGG: bpa:BPP1188
FT                   putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68428"
FT                   /db_xref="GOA:A1AYT4"
FT                   /db_xref="InterPro:IPR003211"
FT                   /db_xref="InterPro:IPR038523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT4"
FT                   /protein_id="ABL68428.1"
FT                   /translation="MADRIPGNCPKRGRACAGGPMLTGFVLFYVGAVLFLNGLWLMGRI
FT                   ADREIVVINIVTALVSGAAVLHDAFGTGASAASIRNGALSLLFCTTYLWVAYNRLSGAD
FT                   GRGLGWFSLFVAVTTVPVFLRALAAAGSATELWLAANWAVWGVLWFMYFLLLALGRPIQ
FT                   RQTAWVTLLAGIFTGWLPGFLLLDGLI"
     MADRIPGNCP KRGRACAGGP MLTGFVLFYV GAVLFLNGLW LMGRIADREI VVINIVTALV        60
     SGAAVLHDAF GTGASAASIR NGALSLLFCT TYLWVAYNRL SGADGRGLGW FSLFVAVTTV       120
     PVFLRALAAA GSATELWLAA NWAVWGVLWF MYFLLLALGR PIQRQTAWVT LLAGIFTGWL       180
     PGFLLLDGLI                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page