(data stored in ACNUC7421 zone)

EMBL: CP000489.PE312

CP000489.PE312       Location/Qualifiers
FT   CDS             complement(295835..297919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0315"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein;
FT                   dihydrodipicolinate reductase; NAD-dependent
FT                   epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; homoserine dehydrogenase,
FT                   NAD-binding; dTDP-4-dehydrorhamnose reductase; NmrA family
FT                   protein; Male sterility C-terminal domain; KEGG:
FT                   sil:SPO0852 oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68429"
FT                   /db_xref="GOA:A1AYT5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT5"
FT                   /protein_id="ABL68429.1"
FT                   /translation="MTSDLRIAILGAGYIASWHADAIKAAPGARLVAVCDPARDAAEAL
FT                   AASHGVAAFTDLDQMIAAGVCDVVHILTPPNLHRDLAVQCLNAGLHVLVEKPVALSVAE
FT                   IDEMEAAATAAGRQLGACHNFLGLPGYERLKRAVQAGELGLVSSAQINWSLPLVPLRSG
FT                   PYGLWMLRETQNLLLELGPHPFSFAVDLFGPLEVEHVSLGQWITLPGGEQRPQSWRILA
FT                   RAGKVDVTIALSLVETFDDRSLSLRGSSGMARLDYAADALVLTRDNTADLVLNPLVKEL
FT                   SRSGAHLREGVRNALRQAASLNQKSPYGLSFRATIAAFYDGIRAGRPDPRFAPSSARAV
FT                   MQGIGDALACLPALPPVPARPIGTPQPRVMVIGGTGFIGRNLTRRLVERGHDVRVLSRG
FT                   RNGPFPDIADHVETLGISLHDEEGLAAAMQGMDCVFNLAKSTDKSWQAALDNDVATTER
FT                   IGRAAIRSGVGRLVHTGTIASYDMSDPARTITEATDFGAMDSRNIYARSKAEGERRLIA
FT                   MQAQGLRLAIARPGIVLGDGGPLQHWGIGRWHGAGAVRLWGNGRNILPFVLADDVSDGL
FT                   IAMMERDEAIGESFNLIGEPMFSGRDYFDAIHRRTGARLKVSGSNLTALWAVDAVKQGL
FT                   KRHALRRKGAAPASLADWKSRGHLSPFDNGKPKRLLGWAPEADRDAFWRRAIDEAHLFW
FT                   "
     MTSDLRIAIL GAGYIASWHA DAIKAAPGAR LVAVCDPARD AAEALAASHG VAAFTDLDQM        60
     IAAGVCDVVH ILTPPNLHRD LAVQCLNAGL HVLVEKPVAL SVAEIDEMEA AATAAGRQLG       120
     ACHNFLGLPG YERLKRAVQA GELGLVSSAQ INWSLPLVPL RSGPYGLWML RETQNLLLEL       180
     GPHPFSFAVD LFGPLEVEHV SLGQWITLPG GEQRPQSWRI LARAGKVDVT IALSLVETFD       240
     DRSLSLRGSS GMARLDYAAD ALVLTRDNTA DLVLNPLVKE LSRSGAHLRE GVRNALRQAA       300
     SLNQKSPYGL SFRATIAAFY DGIRAGRPDP RFAPSSARAV MQGIGDALAC LPALPPVPAR       360
     PIGTPQPRVM VIGGTGFIGR NLTRRLVERG HDVRVLSRGR NGPFPDIADH VETLGISLHD       420
     EEGLAAAMQG MDCVFNLAKS TDKSWQAALD NDVATTERIG RAAIRSGVGR LVHTGTIASY       480
     DMSDPARTIT EATDFGAMDS RNIYARSKAE GERRLIAMQA QGLRLAIARP GIVLGDGGPL       540
     QHWGIGRWHG AGAVRLWGNG RNILPFVLAD DVSDGLIAMM ERDEAIGESF NLIGEPMFSG       600
     RDYFDAIHRR TGARLKVSGS NLTALWAVDA VKQGLKRHAL RRKGAAPASL ADWKSRGHLS       660
     PFDNGKPKRL LGWAPEADRD AFWRRAIDEA HLFW                                   694
//

If you have problems or comments...

PBIL Back to PBIL home page