(data stored in ACNUC7421 zone)

EMBL: CP000489.PE314

CP000489.PE314       Location/Qualifiers
FT   CDS             complement(298982..300166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0317"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; HPP family
FT                   protein+B94; KEGG: rsp:RSP_0830 CBS-domain-containing
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68431"
FT                   /db_xref="GOA:A1AYT7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYT7"
FT                   /protein_id="ABL68431.1"
FT                   /translation="MTRPAGAVLHQIAQALGPAIAPGSPREALRAGIGALAGLGVSGLF
FT                   LLSPTTDLRLGLYMIAPFGATSVLVFAVPNSPLAQPWSAVVGNCVAAAVGVLACMLTPS
FT                   STLCVALAVGVTITAMILLRAVHPPAGAVAMTAALNPEAIRELGFHFVLAPVLTGTLAL
FT                   VGLAMIYARLTGRRYPFRQFDEPGPHGTADHPAMERLGLSREELTEILQRYRQSLNLGV
FT                   EDLARLIGAAELQAATHRTGPLTAADVMSRDLVTVAPHTRLVRVADIFRKHGFTSLPVV
FT                   DGEGRFCGVIFQLHLIRRARDDAFRHDRRFSAAMSDLLTPSRGMPTRAREIMQTDPPHV
FT                   APDTPIGALLPMLASGECDAVPVLDGQRIVGIVTQTDLISALARQSLRQDLPAH"
     MTRPAGAVLH QIAQALGPAI APGSPREALR AGIGALAGLG VSGLFLLSPT TDLRLGLYMI        60
     APFGATSVLV FAVPNSPLAQ PWSAVVGNCV AAAVGVLACM LTPSSTLCVA LAVGVTITAM       120
     ILLRAVHPPA GAVAMTAALN PEAIRELGFH FVLAPVLTGT LALVGLAMIY ARLTGRRYPF       180
     RQFDEPGPHG TADHPAMERL GLSREELTEI LQRYRQSLNL GVEDLARLIG AAELQAATHR       240
     TGPLTAADVM SRDLVTVAPH TRLVRVADIF RKHGFTSLPV VDGEGRFCGV IFQLHLIRRA       300
     RDDAFRHDRR FSAAMSDLLT PSRGMPTRAR EIMQTDPPHV APDTPIGALL PMLASGECDA       360
     VPVLDGQRIV GIVTQTDLIS ALARQSLRQD LPAH                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page