(data stored in ACNUC7421 zone)

EMBL: CP000489.PE317

CP000489.PE317       Location/Qualifiers
FT   CDS             302525..303298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0320"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: pst:PSPTO_5378
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68434"
FT                   /db_xref="GOA:A1AYU0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU0"
FT                   /protein_id="ABL68434.1"
FT                   /translation="MTRNIDLNSDLGEGYGAWKMGDDATMLGIVSSANVACGFHAGDPL
FT                   TILVTVREAAARGVAVGAHVSYPDRVGFGRRPMDVTHAELAADVIYQIGALQGICASAG
FT                   TRVSYVKPHGALYNTIATDPRQGAAVIEGIKAVDPGLAMMGLAGTQILRQAAEAGLPTI
FT                   AEAFADRAYRPDGQLVSRREPGAVLHDPEAVAARMLRLATDGEVEAADGSVLHLHADSI
FT                   CVHGDSPGAVAMAARIREVLLAGGVSIAPAAGGAA"
     MTRNIDLNSD LGEGYGAWKM GDDATMLGIV SSANVACGFH AGDPLTILVT VREAAARGVA        60
     VGAHVSYPDR VGFGRRPMDV THAELAADVI YQIGALQGIC ASAGTRVSYV KPHGALYNTI       120
     ATDPRQGAAV IEGIKAVDPG LAMMGLAGTQ ILRQAAEAGL PTIAEAFADR AYRPDGQLVS       180
     RREPGAVLHD PEAVAARMLR LATDGEVEAA DGSVLHLHAD SICVHGDSPG AVAMAARIRE       240
     VLLAGGVSIA PAAGGAA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page