(data stored in ACNUC7421 zone)

EMBL: CP000489.PE318

CP000489.PE318       Location/Qualifiers
FT   CDS             303295..304086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0321"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   atc:AGR_L_1868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68435"
FT                   /db_xref="GOA:A1AYU1"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AYU1"
FT                   /protein_id="ABL68435.1"
FT                   /translation="MTLLPDPAEARAARLACRQGAPRPTAGMAPGFTQCNMISLPKDWA
FT                   WDFLLYAQRNPKPCPVLDVTDPGSHRTALAPKADLRTDIPLYRIWRDGVLAEETPDATA
FT                   AWAEHPDLVTFLIGCSFTFETPLQQAGIEVRHIAQGCNVPMFLTDRDCRPAGRLHGKMV
FT                   VSMRPIPAGRVAEAAMISGRTPAVHGAPVHIGAPEALGIADLSRPDFGDPVQIRPGEVP
FT                   VFWACGVTPQAALMASKPPFAITHAPGYMFITDVPDTHWQV"
     MTLLPDPAEA RAARLACRQG APRPTAGMAP GFTQCNMISL PKDWAWDFLL YAQRNPKPCP        60
     VLDVTDPGSH RTALAPKADL RTDIPLYRIW RDGVLAEETP DATAAWAEHP DLVTFLIGCS       120
     FTFETPLQQA GIEVRHIAQG CNVPMFLTDR DCRPAGRLHG KMVVSMRPIP AGRVAEAAMI       180
     SGRTPAVHGA PVHIGAPEAL GIADLSRPDF GDPVQIRPGE VPVFWACGVT PQAALMASKP       240
     PFAITHAPGY MFITDVPDTH WQV                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page