(data stored in ACNUC7421 zone)

EMBL: CP000489.PE32

CP000489.PE32        Location/Qualifiers
FT   CDS             26711..27313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0032"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   sit:TM1040_3754 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68149"
FT                   /db_xref="GOA:A1AY05"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY05"
FT                   /protein_id="ABL68149.1"
FT                   /translation="MSPVPAVILAGGLSTRMGGGNKALRMLAGETLLSRVIARLSPQCG
FT                   PLAINANGEPGQFEEYGLPVIADGIAGFAGPLAGVLAGMEWAAGEGADSVVSVSVDTPF
FT                   LPEDLVHRLREAAGRSGVAIAASPDDSGQLRDHPTCALWPVSLRGELRDALESGLHRIG
FT                   QFAAAHDPGRAVFDSRPVDPFLNLNTPEDLARAARLV"
     MSPVPAVILA GGLSTRMGGG NKALRMLAGE TLLSRVIARL SPQCGPLAIN ANGEPGQFEE        60
     YGLPVIADGI AGFAGPLAGV LAGMEWAAGE GADSVVSVSV DTPFLPEDLV HRLREAAGRS       120
     GVAIAASPDD SGQLRDHPTC ALWPVSLRGE LRDALESGLH RIGQFAAAHD PGRAVFDSRP       180
     VDPFLNLNTP EDLARAARLV                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page