(data stored in ACNUC7421 zone)

EMBL: CP000489.PE322

CP000489.PE322       Location/Qualifiers
FT   CDS             308566..309129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0325"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   mlo:mlr8324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68439"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU5"
FT                   /protein_id="ABL68439.1"
FT                   /translation="MSHRILKAADHRRMPWKNGRGETVEIAVHPQGAGLADFGWRVSMA
FT                   GVSEDGDFSIFPQIDRTLAVLTGEGIELDVQGQARRRLTPESGPLAFPADVPTSARLLG
FT                   GPITDLNVMTRRGAFTHRLSRLTEAAVGAPGWRLVLATAPVVLDLAGATVALDQLDALF
FT                   CEGPDAALPVGPAADAWLIEIDRA"
     MSHRILKAAD HRRMPWKNGR GETVEIAVHP QGAGLADFGW RVSMAGVSED GDFSIFPQID        60
     RTLAVLTGEG IELDVQGQAR RRLTPESGPL AFPADVPTSA RLLGGPITDL NVMTRRGAFT       120
     HRLSRLTEAA VGAPGWRLVL ATAPVVLDLA GATVALDQLD ALFCEGPDAA LPVGPAADAW       180
     LIEIDRA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page