(data stored in ACNUC7421 zone)

EMBL: CP000489.PE323

CP000489.PE323       Location/Qualifiers
FT   CDS             complement(309179..310213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0326"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mlo:mll2315
FT                   alkanal monooxygenase (bacterial liciferase alpha chain)
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68440"
FT                   /db_xref="GOA:A1AYU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU6"
FT                   /protein_id="ABL68440.1"
FT                   /translation="MKKIGVKKIGFLSFGHWSDEPASQARSAQDTLLQSIELAVAAEEL
FT                   GADGAYFRVHHYARQLASPFPLLAAVGARTQRIEIGTAVIDMRYENPLYMAEDAGAADL
FT                   ISQGRLQLGISRGSPEQVIEGWRYFGYTPAEEESDADMARRHAEVFLNVIEGHGFARPN
FT                   PRPMFPNPPGLLRIEPHSPGLRERIWWGAASNDTARWAAQLGMHLQSSTLKTDENGKPF
FT                   HVQQAEQIRAYREAWAAAGHEREPRVSVSRSIFPLMDDRDRMYFGRGGKEADQIGFIEE
FT                   TRSIFGRGYTAEPDRLIEELREDEAIAEADTLLLTVPNQLGVDYNAHVIEAVLSHVAPA
FT                   LGWR"
     MKKIGVKKIG FLSFGHWSDE PASQARSAQD TLLQSIELAV AAEELGADGA YFRVHHYARQ        60
     LASPFPLLAA VGARTQRIEI GTAVIDMRYE NPLYMAEDAG AADLISQGRL QLGISRGSPE       120
     QVIEGWRYFG YTPAEEESDA DMARRHAEVF LNVIEGHGFA RPNPRPMFPN PPGLLRIEPH       180
     SPGLRERIWW GAASNDTARW AAQLGMHLQS STLKTDENGK PFHVQQAEQI RAYREAWAAA       240
     GHEREPRVSV SRSIFPLMDD RDRMYFGRGG KEADQIGFIE ETRSIFGRGY TAEPDRLIEE       300
     LREDEAIAEA DTLLLTVPNQ LGVDYNAHVI EAVLSHVAPA LGWR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page