(data stored in ACNUC7421 zone)

EMBL: CP000489.PE325

CP000489.PE325       Location/Qualifiers
FT   CDS             311304..312248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0328"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01961 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68442"
FT                   /db_xref="GOA:A1AYU8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU8"
FT                   /protein_id="ABL68442.1"
FT                   /translation="MELTGIHHLTAITADAPGNKRFYTDTLGLRLVKKTVNQDDTSAYH
FT                   LFYADGLARPGTDLTFFDWPAAPERRGTHSISRTGLRVAGDSLDYWAGRLADRGLTLGR
FT                   VAEIDTRASLDFEDPEGQRFRLTEDAQDAVTAPWEKSPVPAQHQIHGLGPITISVPDLA
FT                   PTEIVLTHVMGMRKVRDYASPDGHGTVHVYEMGQGGPSAELHVAVQPDLAVARQGAGGV
FT                   HHVAFRVPDKPAIHDWARRLNEMRVPSSGEVERYYFRSLYFREPGGNLFEIASDEPGFA
FT                   VDEPLESLGETLSLPPFLEGQRAQIEARLKPLD"
     MELTGIHHLT AITADAPGNK RFYTDTLGLR LVKKTVNQDD TSAYHLFYAD GLARPGTDLT        60
     FFDWPAAPER RGTHSISRTG LRVAGDSLDY WAGRLADRGL TLGRVAEIDT RASLDFEDPE       120
     GQRFRLTEDA QDAVTAPWEK SPVPAQHQIH GLGPITISVP DLAPTEIVLT HVMGMRKVRD       180
     YASPDGHGTV HVYEMGQGGP SAELHVAVQP DLAVARQGAG GVHHVAFRVP DKPAIHDWAR       240
     RLNEMRVPSS GEVERYYFRS LYFREPGGNL FEIASDEPGF AVDEPLESLG ETLSLPPFLE       300
     GQRAQIEARL KPLD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page