(data stored in ACNUC7421 zone)

EMBL: CP000489.PE326

CP000489.PE326       Location/Qualifiers
FT   CDS             312401..312802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr6753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68443"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYU9"
FT                   /protein_id="ABL68443.1"
FT                   /translation="MSQSEKGTPASELIDARIRELGNWRGETLARLRALIHEADPEVVE
FT                   EWKWRGVPVWSHDGILCTGETYSQVVKMTFAKGAALEDPSGLFNASLEGNTRRAIDLRE
FT                   GERIKAEALKALIRAAVALNRARKKGRSK"
     MSQSEKGTPA SELIDARIRE LGNWRGETLA RLRALIHEAD PEVVEEWKWR GVPVWSHDGI        60
     LCTGETYSQV VKMTFAKGAA LEDPSGLFNA SLEGNTRRAI DLREGERIKA EALKALIRAA       120
     VALNRARKKG RSK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page