(data stored in ACNUC7421 zone)

EMBL: CP000489.PE334

CP000489.PE334       Location/Qualifiers
FT   CDS             complement(319992..320720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68451"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV7"
FT                   /protein_id="ABL68451.1"
FT                   /translation="MTAALRVGVLCETSGTMRRAFAALGHDATSVDRLPAEDGSNHHIV
FT                   GDVRDYLDYGWDLLIVCHPPCTRLCNSGVRWLSDPPKNPPDDATPAEKVAWPILPREAR
FT                   LAIMWRLLDEGAELFAACWQAPVARVAVENPVMHKHGRARMPADLPKPQIVQPWWFDEP
FT                   AFKATGFYLRGLPPLTATKRLIPPSAATEPERHKAWSAIHRASPGPDRWKIRSRTFDGI
FT                   ARACAEQWGGYALDQIRRMA"
     MTAALRVGVL CETSGTMRRA FAALGHDATS VDRLPAEDGS NHHIVGDVRD YLDYGWDLLI        60
     VCHPPCTRLC NSGVRWLSDP PKNPPDDATP AEKVAWPILP REARLAIMWR LLDEGAELFA       120
     ACWQAPVARV AVENPVMHKH GRARMPADLP KPQIVQPWWF DEPAFKATGF YLRGLPPLTA       180
     TKRLIPPSAA TEPERHKAWS AIHRASPGPD RWKIRSRTFD GIARACAEQW GGYALDQIRR       240
     MA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page